Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [228081] (1 PDB entry) |
Domain d4l41b_: 4l41 B: [228082] Other proteins in same PDB: d4l41c_ automated match to d3lzta_ complexed with ca, so4 |
PDB Entry: 4l41 (more details), 2.7 Å
SCOPe Domain Sequences for d4l41b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l41b_ d.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} akqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl ce
Timeline for d4l41b_: