Lineage for d4l41b_ (4l41 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1634020Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1634021Protein automated matches [190563] (11 species)
    not a true protein
  7. 1634032Species Human (Homo sapiens) [TaxId:9606] [228081] (1 PDB entry)
  8. 1634034Domain d4l41b_: 4l41 B: [228082]
    Other proteins in same PDB: d4l41c_
    automated match to d3lzta_
    complexed with ca, so4

Details for d4l41b_

PDB Entry: 4l41 (more details), 2.7 Å

PDB Description: Human Lactose synthase: A 2:1 complex between human alpha-lactalbumin and human beta1,4-galactosyltransferase
PDB Compounds: (B:) alpha-lactalbumin

SCOPe Domain Sequences for d4l41b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l41b_ d.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnkl
wckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwl
ce

SCOPe Domain Coordinates for d4l41b_:

Click to download the PDB-style file with coordinates for d4l41b_.
(The format of our PDB-style files is described here.)

Timeline for d4l41b_: