Lineage for d4kgnd_ (4kgn D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884654Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 1884655Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 1884797Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 1884798Protein automated matches [190961] (13 species)
    not a true protein
  7. 1884821Species Burkholderia pseudomallei [TaxId:425067] [188581] (2 PDB entries)
  8. 1884823Domain d4kgnd_: 4kgn D: [202846]
    automated match to d3e5ya_
    complexed with cl, sah

Details for d4kgnd_

PDB Entry: 4kgn (more details), 2.15 Å

PDB Description: Crystal structure of a tRNA (cytidine(34)-2'-O)-methyltransferase bound to S-adenosyl homocysteine
PDB Compounds: (D:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4kgnd_:

Sequence, based on SEQRES records: (download)

>d4kgnd_ c.116.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 425067]}
gsmfnvvlvepeippntgnvirlcantgarlhlieplgfplddakmrragldyheyaqmr
vhrdwdafvaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfap
eqrvrlpmrpgnrslnlsntvavvvfeawrqagfegga

Sequence, based on observed residues (ATOM records): (download)

>d4kgnd_ c.116.1.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 425067]}
gsmfnvvlvepeippntgnvirlcantgarlhlieplgfplgldyheyaqmrvhrdwdaf
vaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeqrvrlpm
rpgnrslnlsntvavvvfeawrqagfegga

SCOPe Domain Coordinates for d4kgnd_:

Click to download the PDB-style file with coordinates for d4kgnd_.
(The format of our PDB-style files is described here.)

Timeline for d4kgnd_: