Lineage for d4k00a_ (4k00 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944655Species Synechocystis sp. [TaxId:1111708] [226643] (1 PDB entry)
  8. 2944656Domain d4k00a_: 4k00 A: [224095]
    automated match to d1s5ue_
    complexed with edo

Details for d4k00a_

PDB Entry: 4k00 (more details), 1.9 Å

PDB Description: Crystal structure of Slr0204, a 1,4-dihydroxy-2-naphthoyl-CoA thioesterase from Synechocystis
PDB Compounds: (A:) 1,4-dihydroxy-2-naphthoyl-CoA hydrolase

SCOPe Domain Sequences for d4k00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k00a_ d.38.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
gtftyerqvyladtdgagvvyfnqflqmcheayeswlssehlslqniisvgdfalplvha
sidffapahcgdrllvnltitqasahrfccdyeisqaesaqllaraqthhvcialperkk
aplpqpwqtaicdldhp

SCOPe Domain Coordinates for d4k00a_:

Click to download the PDB-style file with coordinates for d4k00a_.
(The format of our PDB-style files is described here.)

Timeline for d4k00a_: