SCOPe 2.08: Domain d4k00b_: 4k00 B:

Lineage for d4k00b_ (4k00 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [226643] (1 PDB entry)

8. Domain d4k00b_: 4k00 B: [224096]
   automated match to d1s5ue_
   complexed with edo

Details for d4k00b_

PDB Entry: 4k00, 1.9 Å

PDB Description: Crystal structure of Slr0204, a 1,4-dihydroxy-2-naphthoyl-CoA thioesterase from Synechocystis

PDB Compounds: (B:) 1,4-dihydroxy-2-naphthoyl-CoA hydrolase

SCOPe Domain Sequences for d4k00b_:

Sequence; same for both SEQRES and ATOM records:

>d4k00b_ d.38.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
tftyerqvyladtdgagvvyfnqflqmcheayeswlssehlslqniisvgdfalplvhas
idffapahcgdrllvnltitqasahrfccdyeisqaesaqllaraqthhvcialperkka
plpqpwqtaicdldhp

Timeline for d4k00b_:

• d4k00b_ first appeared in SCOPe 2.03
  
• d4k00b_ appears in SCOPe 2.07