Lineage for d4jqua_ (4jqu A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (5 families) 
Family d.20.1.1: UBC-related [54496] (7 proteins) 
Protein automated matches [190124] (12 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (3 PDB entries) 
Domain d4jqua_: 4jqu A: [197197]
automated match to d2ucza_
complexed with btb, peg
Details for d4jqua_
PDB Entry: 4jqu (more details), 1.81 Å
PDB Description: crystal structure of ubc7p in complex with the u7br of cue1p
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 7SCOPe Domain Sequences for d4jqua_:
Sequence, based on SEQRES records: (download)
>d4jqua_ d.20.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsaaasktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfna
klefpkdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsv
ekillsvmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
Sequence, based on observed residues (ATOM records): (download)
>d4jqua_ d.20.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsaaasktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfna
klefpkdyplsppkltftpsilhpniypngevcisilhspyelaeerwspvqsvekills
vmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
SCOPe Domain Coordinates for d4jqua_:
Click to download the PDB-style file with coordinates for d4jqua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jqua_:
- d4jqua_ first appeared in SCOPe 2.02
- d4jqua_ appears in SCOPe 2.04
- d4jqua_ is called d4jqua1 in SCOPe 2.06
- d4jqua_ appears in the current release, SCOPe 2.08, called d4jqua1
View in 3D
