Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [195012] (1 PDB entry) |
Domain d4f3rc_: 4f3r C: [195013] automated match to d3l93a_ complexed with ca |
PDB Entry: 4f3r (more details), 2.25 Å
SCOPe Domain Sequences for d4f3rc_:
Sequence, based on SEQRES records: (download)
>d4f3rc_ c.26.1.0 (C:) automated matches {Coxiella burnetii [TaxId: 227377]} mkpiaiypgtfdpltnghvdiieralplfnkiivacaptsrkdphlkleervnliadvlt dervevlpltgllvdfakthqanfilrglravsdfdyefqlahmnyqlspeietiflpar egysyvsgtmvreivtlggdvspfvpplvarhlq
>d4f3rc_ c.26.1.0 (C:) automated matches {Coxiella burnetii [TaxId: 227377]} mkpiaiypgtfdpltnghvdiieralplfnkiivacaptkleervnliadvltdervevl pltgllvdfakthqanfilrglravsdfdyefqlahmnyqlspeietiflparegysyvs gtmvreivtlggdvspfvpplvarhlq
Timeline for d4f3rc_: