Lineage for d4c7va1 (4c7v A:1-336)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844736Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 1844737Protein automated matches [227126] (15 species)
    not a true protein
  7. 1844863Species Lactobacillus salivarius [TaxId:362948] [260140] (2 PDB entries)
  8. 1844864Domain d4c7va1: 4c7v A:1-336 [260145]
    Other proteins in same PDB: d4c7va3
    automated match to d3m49a1

Details for d4c7va1

PDB Entry: 4c7v (more details), 2.2 Å

PDB Description: apo transketolase from lactobacillus salivarius at 2.2a resolution
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d4c7va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7va1 c.36.1.0 (A:1-336) automated matches {Lactobacillus salivarius [TaxId: 362948]}
pydqvdqlgvntlrtlsidaiqransghpglpmgaapmayvlwtrhlkinpkthmnwvnr
drfvlsaghgsallyslahlagydvsmddlknfrewksntpghpeygctdgveattgplg
qgismavgmamaeahlgkkfnregypvmdhytyaligdgdlmegvaseaaslaghlklgk
lialydsngisldgktsasftenvgarfeaygwqyilvedgfnleeidkaivqakaesdk
ptiieikttigygsenqgthkvhgsplgeegvahakevynwnyppftvpeevsqrfkecl
qdkgvkaenkwnemfeaykkeysdlaqkfsdgfsnk

SCOPe Domain Coordinates for d4c7va1:

Click to download the PDB-style file with coordinates for d4c7va1.
(The format of our PDB-style files is described here.)

Timeline for d4c7va1: