SCOPe 2.04: Domain d4c7va1: 4c7v A:1-336

Lineage for d4c7va1 (4c7v A:1-336)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family
6. Protein automated matches [227126] (15 species)
   not a true protein

7. Species Lactobacillus salivarius [TaxId:362948] [260140] (1 PDB entry)

8. Domain d4c7va1: 4c7v A:1-336 [260145]
   Other proteins in same PDB: d4c7va3
   automated match to d3m49a1

Details for d4c7va1

PDB Entry: 4c7v, 2.2 Å

PDB Description: apo transketolase from lactobacillus salivarius at 2.2a resolution

PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d4c7va1:

Sequence; same for both SEQRES and ATOM records:

>d4c7va1 c.36.1.0 (A:1-336) automated matches {Lactobacillus salivarius [TaxId: 362948]}
pydqvdqlgvntlrtlsidaiqransghpglpmgaapmayvlwtrhlkinpkthmnwvnr
drfvlsaghgsallyslahlagydvsmddlknfrewksntpghpeygctdgveattgplg
qgismavgmamaeahlgkkfnregypvmdhytyaligdgdlmegvaseaaslaghlklgk
lialydsngisldgktsasftenvgarfeaygwqyilvedgfnleeidkaivqakaesdk
ptiieikttigygsenqgthkvhgsplgeegvahakevynwnyppftvpeevsqrfkecl
qdkgvkaenkwnemfeaykkeysdlaqkfsdgfsnk

Timeline for d4c7va1:

• d4c7va1 is new in SCOPe 2.04-stable
  
• d4c7va1 appears in SCOPe 2.05
  
• d4c7va1 appears in the current release, SCOPe 2.08