Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (12 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226337] (1 PDB entry) |
Domain d3zq7a_: 3zq7 A: [218399] automated match to d1gxqa_ |
PDB Entry: 3zq7 (more details), 2.52 Å
SCOPe Domain Sequences for d3zq7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zq7a_ a.4.6.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} pdplvkfsdvtvdlaarvihrgeeevhltpiefrllavllnnagkvltqrqllnqvwgpn avehshylriymghlrqkleqdparprhfitetgigyrfml
Timeline for d3zq7a_: