Lineage for d1gxqa_ (1gxq A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480304Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1480305Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 1480311Protein PhoB [46898] (2 species)
  7. 1480312Species Escherichia coli [TaxId:562] [46899] (4 PDB entries)
  8. 1480313Domain d1gxqa_: 1gxq A: [70721]

Details for d1gxqa_

PDB Entry: 1gxq (more details), 2 Å

PDB Description: Crystal structure of the PhoB effector domain
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein

SCOPe Domain Sequences for d1gxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxqa_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]}
pmaveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvw
gtnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf

SCOPe Domain Coordinates for d1gxqa_:

Click to download the PDB-style file with coordinates for d1gxqa_.
(The format of our PDB-style files is described here.)

Timeline for d1gxqa_: