Lineage for d3zq7a_ (3zq7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695324Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 2695325Protein automated matches [190858] (25 species)
    not a true protein
  7. 2695339Species Escherichia coli K-12 [TaxId:83333] [226337] (1 PDB entry)
  8. 2695340Domain d3zq7a_: 3zq7 A: [218399]
    automated match to d1gxqa_

Details for d3zq7a_

PDB Entry: 3zq7 (more details), 2.52 Å

PDB Description: the structure of dna-binding domain of response regulator from escherichia coli k-12
PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d3zq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zq7a_ a.4.6.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pdplvkfsdvtvdlaarvihrgeeevhltpiefrllavllnnagkvltqrqllnqvwgpn
avehshylriymghlrqkleqdparprhfitetgigyrfml

SCOPe Domain Coordinates for d3zq7a_:

Click to download the PDB-style file with coordinates for d3zq7a_.
(The format of our PDB-style files is described here.)

Timeline for d3zq7a_: