Lineage for d3wwka_ (3wwk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235083Protein automated matches [190329] (9 species)
    not a true protein
  7. 2235138Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (3 PDB entries)
  8. 2235153Domain d3wwka_: 3wwk A: [260626]
    Other proteins in same PDB: d3wwkc_, d3wwke_, d3wwkf_, d3wwki_, d3wwkl_
    automated match to d3bx4c_

Details for d3wwka_

PDB Entry: 3wwk (more details), 2.98 Å

PDB Description: crystal structure of clec-2 in complex with rhodocytin
PDB Compounds: (A:) Snaclec rhodocytin subunit alpha

SCOPe Domain Sequences for d3wwka_:

Sequence, based on SEQRES records: (download)

>d3wwka_ d.169.1.1 (A:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
deladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvny
yceqmhafvckllpy

Sequence, based on observed residues (ATOM records): (download)

>d3wwka_ d.169.1.1 (A:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
deladedyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyc
eqmhafvckllpy

SCOPe Domain Coordinates for d3wwka_:

Click to download the PDB-style file with coordinates for d3wwka_.
(The format of our PDB-style files is described here.)

Timeline for d3wwka_: