Lineage for d3wwka_ (3wwk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682506Protein automated matches [190329] (7 species)
    not a true protein
  7. 1682543Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (2 PDB entries)
  8. 1682546Domain d3wwka_: 3wwk A: [260626]
    Other proteins in same PDB: d3wwkc_, d3wwke_
    automated match to d3bx4c_

Details for d3wwka_

PDB Entry: 3wwk (more details), 2.98 Å

PDB Description: crystal structure of clec-2 in complex with rhodocytin
PDB Compounds: (A:) Snaclec rhodocytin subunit alpha

SCOPe Domain Sequences for d3wwka_:

Sequence, based on SEQRES records: (download)

>d3wwka_ d.169.1.1 (A:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
deladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvny
yceqmhafvckllpy

Sequence, based on observed residues (ATOM records): (download)

>d3wwka_ d.169.1.1 (A:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
ledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqk
deladedyvwiglraqnkeqqcssewsdgssvsyenllhtkkcgalekltgfrkwvnyyc
eqmhafvckllpy

SCOPe Domain Coordinates for d3wwka_:

Click to download the PDB-style file with coordinates for d3wwka_.
(The format of our PDB-style files is described here.)

Timeline for d3wwka_: