Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Pyrobaculum calidifontis [TaxId:410359] [189396] (6 PDB entries) |
Domain d3w6za1: 3w6z A:1-161 [250728] Other proteins in same PDB: d3w6za2, d3w6za3 automated match to d3w6ua1 complexed with nap |
PDB Entry: 3w6z (more details), 1.44 Å
SCOPe Domain Sequences for d3w6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w6za1 c.2.1.0 (A:1-161) automated matches {Pyrobaculum calidifontis [TaxId: 410359]} mrvgfiglgimggpmathllkagflaavynrtrektkpfaeagvyvaespadlakrvdvv ivmvsdapdveqvlfgpsgvvegarpglivvdmstnspdwarkfaerlaqygiefldapv tggqkgaiegtltimvggkeelfhrllpifkamgrdivymg
Timeline for d3w6za1: