SCOPe 2.04: Domain d3w6za1: 3w6z A:-12-161

Lineage for d3w6za1 (3w6z A:-12-161)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Pyrobaculum calidifontis [TaxId:410359] [189396] (4 PDB entries)

8. Domain d3w6za1: 3w6z A:-12-161 [250728]
   Other proteins in same PDB: d3w6za2
   automated match to d3w6ua1
   complexed with nap

Details for d3w6za1

PDB Entry: 3w6z, 1.44 Å

PDB Description: crystal structure of nadp bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, NAD-binding protein

SCOPe Domain Sequences for d3w6za1:

Sequence; same for both SEQRES and ATOM records:

>d3w6za1 c.2.1.0 (A:-12-161) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
hhhssglvprgshmrvgfiglgimggpmathllkagflaavynrtrektkpfaeagvyva
espadlakrvdvvivmvsdapdveqvlfgpsgvvegarpglivvdmstnspdwarkfaer
laqygiefldapvtggqkgaiegtltimvggkeelfhrllpifkamgrdivymg

Timeline for d3w6za1:

• d3w6za1 is new in SCOPe 2.04-stable
  
• d3w6za1 appears in SCOPe 2.05
  
• d3w6za1 appears in the current release, SCOPe 2.08