Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (74 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [225618] (5 PDB entries) |
Domain d3vdga2: 3vdg A:139-423 [233847] Other proteins in same PDB: d3vdga1, d3vdga3 automated match to d4it1d2 complexed with act, cl, fmt, na |
PDB Entry: 3vdg (more details), 1.9 Å
SCOPe Domain Sequences for d3vdga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdga2 c.1.11.0 (A:139-423) automated matches {Mycobacterium smegmatis [TaxId: 246196]} gavrdavpfsaylfykwaahpgaepdgwgaaldpdgivaqarrmideygfsaiklkggvf apeeemaavealraafpdhplrldpnaawtpqtsvkvaaglegvleyledptpgldgmae vaaqapmplatnmcvvafdqlpaavaknsvqvvlsdhhywgglqrsrllagicdtfglgl smhsnshlgislaamvhlaaatpnltyacdthwpwrhedvvapgalnfcdgevqvpatpg lgveidedalaalheqylrcgirdrddtgymrsidpgfnasgprw
Timeline for d3vdga2: