Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries) |
Domain d3vdga1: 3vdg A:1-138 [233846] Other proteins in same PDB: d3vdga2, d3vdga3 automated match to d4it1d1 complexed with act, cl, fmt, na |
PDB Entry: 3vdg (more details), 1.9 Å
SCOPe Domain Sequences for d3vdga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdga1 d.54.1.0 (A:1-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]} mahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvhl erlqaaahaivgrsvfstnviralisdalggdrtgdgsglagmitsasvvdrvfspfeva cldvqgqvtgrpvsdllg
Timeline for d3vdga1: