![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (19 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries) |
![]() | Domain d3rrqa_: 3rrq A: [195364] automated match to d3bikc_ |
PDB Entry: 3rrq (more details), 2.1 Å
SCOPe Domain Sequences for d3rrqa_:
Sequence, based on SEQRES records: (download)
>d3rrqa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd crfrvtqlpngrdfhmsvvrarrndsgtylcgaislapklqikeslraelrvterra
>d3rrqa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} npptfspallvvtegdnatftcsfsntssfvlnwyrmspsnqtdklaafpecrfrvtqlp ngrdfhmsvvrarrndsgtylcgaislapklqikeslraelrvterra
Timeline for d3rrqa_: