Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (31 PDB entries) |
Domain d3rrqa_: 3rrq A: [195364] automated match to d3bikc_ |
PDB Entry: 3rrq (more details), 2.1 Å
SCOPe Domain Sequences for d3rrqa_:
Sequence, based on SEQRES records: (download)
>d3rrqa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} npptfspallvvtegdnatftcsfsntsesfvlnwyrmspsnqtdklaafpedrsqpgqd crfrvtqlpngrdfhmsvvrarrndsgtylcgaislapklqikeslraelrvterra
>d3rrqa_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} npptfspallvvtegdnatftcsfsntssfvlnwyrmspsnqtdklaafpecrfrvtqlp ngrdfhmsvvrarrndsgtylcgaislapklqikeslraelrvterra
Timeline for d3rrqa_: