Lineage for d3qtpa1 (3qtp A:1-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555076Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226172] (1 PDB entry)
  8. 2555077Domain d3qtpa1: 3qtp A:1-138 [215403]
    Other proteins in same PDB: d3qtpa2, d3qtpa3, d3qtpb2, d3qtpb3
    automated match to d1pdza2
    complexed with 2pg, mg, so4

Details for d3qtpa1

PDB Entry: 3qtp (more details), 1.9 Å

PDB Description: Crystal Structure Analysis of Entamoeba histolytica Enolase
PDB Compounds: (A:) enolase 1

SCOPe Domain Sequences for d3qtpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qtpa1 d.54.1.0 (A:1-138) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
msiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkkryggk
gvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsmsicraa
aaekglplykylaeltgh

SCOPe Domain Coordinates for d3qtpa1:

Click to download the PDB-style file with coordinates for d3qtpa1.
(The format of our PDB-style files is described here.)

Timeline for d3qtpa1: