SCOPe 2.07: Domain d3qtpb1: 3qtp B:1-138

Lineage for d3qtpb1 (3qtp B:1-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226172] (1 PDB entry)

8. Domain d3qtpb1: 3qtp B:1-138 [215405]
   Other proteins in same PDB: d3qtpa2, d3qtpa3, d3qtpb2, d3qtpb3
   automated match to d1pdza2
   complexed with 2pg, mg, so4

Details for d3qtpb1

PDB Entry: 3qtp, 1.9 Å

PDB Description: Crystal Structure Analysis of Entamoeba histolytica Enolase

PDB Compounds: (B:) enolase 1

SCOPe Domain Sequences for d3qtpb1:

Sequence; same for both SEQRES and ATOM records:

>d3qtpb1 d.54.1.0 (B:1-138) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
msiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkkryggk
gvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsmsicraa
aaekglplykylaeltgh

Timeline for d3qtpb1:

• d3qtpb1 first appeared in SCOPe 2.03
  
• d3qtpb1 appears in SCOPe 2.06
  
• d3qtpb1 appears in the current release, SCOPe 2.08