Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [226172] (1 PDB entry) |
Domain d3qtpb1: 3qtp B:1-138 [215405] Other proteins in same PDB: d3qtpa2, d3qtpa3, d3qtpb2, d3qtpb3 automated match to d1pdza2 complexed with 2pg, mg, so4 |
PDB Entry: 3qtp (more details), 1.9 Å
SCOPe Domain Sequences for d3qtpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qtpb1 d.54.1.0 (B:1-138) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} msiqkvhareildsrgnptieveittgkgmfrscvpsgastgvheavelrdgdkkryggk gvlkavenvntiigpallgknvlnqaeldemmikldgtnnkgklganailgcsmsicraa aaekglplykylaeltgh
Timeline for d3qtpb1: