Lineage for d1pdza2 (1pdz A:1-139)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
C-terminal domain is beta/alpha-barrel
Protein Enolase [54828] (10 species) 
Species European lobster (Homarus vulgaris) [TaxId:6707] [54830] (2 PDB entries) 
Domain d1pdza2: 1pdz A:1-139 [38859]
Other proteins in same PDB: d1pdza1
complexed with mn, pga
Details for d1pdza2
PDB Entry: 1pdz (more details), 2.2 Å
PDB Description: x-ray structure and catalytic mechanism of lobster enolase
PDB Compounds: (A:) enolaseSCOPe Domain Sequences for d1pdza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdza2 d.54.1.1 (A:1-139) Enolase {European lobster (Homarus vulgaris) [TaxId: 6707]}
sitkvfartifdsrgnptvevdlytskglfraavpsgastgvhealemrdgdkskyhgks
vfnavknvndvivpeiiksglkvtqqkecdefmckldgtenksslganailgvslaicka
gaaelgiplyrhianlany
SCOPe Domain Coordinates for d1pdza2:
Click to download the PDB-style file with coordinates for d1pdza2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pdza2:
- d1pdza2 first appeared (with stable ids) in SCOP 1.55, called d1pdz_2
- d1pdza2 appears in SCOPe 2.06
- d1pdza2 appears in the current release, SCOPe 2.08
View in 3D
