Lineage for d3qb9f_ (3qb9 F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729920Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)
  8. 1729926Domain d3qb9f_: 3qb9 F: [196064]
    automated match to d3bkna_
    complexed with fe, hem, na

Details for d3qb9f_

PDB Entry: 3qb9 (more details), 2.11 Å

PDB Description: Mycobacterium tuberculosis bacterioferritin, BfrA
PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d3qb9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qb9f_ a.25.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
ekivadeeehidyletqlelmdklgeelysaqcvsrppt

SCOPe Domain Coordinates for d3qb9f_:

Click to download the PDB-style file with coordinates for d3qb9f_.
(The format of our PDB-style files is described here.)

Timeline for d3qb9f_: