SCOPe 2.04: Domain d3qb9f_: 3qb9 F:

Lineage for d3qb9f_ (3qb9 F:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (29 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries)

8. Domain d3qb9f_: 3qb9 F: [196064]
   automated match to d3bkna_
   complexed with fe, hem, na

Details for d3qb9f_

PDB Entry: 3qb9, 2.11 Å

PDB Description: Mycobacterium tuberculosis bacterioferritin, BfrA

PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d3qb9f_:

Sequence; same for both SEQRES and ATOM records:

>d3qb9f_ a.25.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
ekivadeeehidyletqlelmdklgeelysaqcvsrppt

Timeline for d3qb9f_:

• d3qb9f_ first appeared in SCOPe 2.02
  
• d3qb9f_ appears in SCOPe 2.03
  
• d3qb9f_ appears in SCOPe 2.05
  
• d3qb9f_ appears in the current release, SCOPe 2.08