Lineage for d3l8ub_ (3l8u B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.116: alpha/beta knot [75216] (1 superfamily)
core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knotSuperfamily c.116.1: alpha/beta knot [75217] (9 families) 
known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
all known members have dimeric structures
Family c.116.1.0: automated matches [191557] (1 protein)
not a true familyProtein automated matches [190961] (13 species)
not a true protein
Species Streptococcus mutans [TaxId:210007] [189590] (1 PDB entry) 
Domain d3l8ub_: 3l8u B: [180094]
automated match to d1j85a_
Details for d3l8ub_
PDB Entry: 3l8u (more details), 2 Å
PDB Description: Crystal structure of SMU.1707c, a putative rRNA methyltransferase from streptococcus mutans UA159
PDB Compounds: (B:) Putative rRNA methylaseSCOPe Domain Sequences for d3l8ub_:
Sequence, based on SEQRES records: (download)
>d3l8ub_ c.116.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
lgrnhvvlfqpqipantgniartcaatntslhiirpmgfpiddkkmkragldywdkldvh
fydslndfmnicsgklhlitkfanktysdenyddsehhyflfgredkglpeefmrqhsek
alripvndqhvrslnlsntvcmivyealrqqdfiglelshtya
Sequence, based on observed residues (ATOM records): (download)
>d3l8ub_ c.116.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
lgrnhvvlfqpqipantgniartcaatntslhiirpmgfpiddkkmldvhfydslndfmn
icsgklhlitkfanktysdenyddsehhyflfgredkglpeefmrqhsekalripvndqh
vrslnlsntvcmivyealrqqdfiglelshtya
SCOPe Domain Coordinates for d3l8ub_:
Click to download the PDB-style file with coordinates for d3l8ub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l8ub_:
- d3l8ub_ first appeared in SCOPe 2.01
- d3l8ub_ appears in SCOPe 2.04
- d3l8ub_ appears in SCOPe 2.06
- d3l8ub_ appears in the current release, SCOPe 2.08
View in 3D
