Lineage for d3kxse_ (3kxs E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738833Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 1738834Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) (S)
    automatically mapped to Pfam PF00906
  5. 1738835Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 1738842Protein automated matches [191131] (3 species)
    not a true protein
  7. 1738857Species Hepatitis b virus [TaxId:10419] [189224] (1 PDB entry)
  8. 1738862Domain d3kxse_: 3kxs E: [179800]
    automated match to d1qgtb_
    mutant

Details for d3kxse_

PDB Entry: 3kxs (more details), 2.25 Å

PDB Description: crystal structure of hbv capsid mutant dimer (oxy form), strain adyw
PDB Compounds: (E:) capsid protein

SCOPe Domain Sequences for d3kxse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kxse_ a.62.1.1 (E:) automated matches {Hepatitis b virus [TaxId: 10419]}
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilstl

SCOPe Domain Coordinates for d3kxse_:

Click to download the PDB-style file with coordinates for d3kxse_.
(The format of our PDB-style files is described here.)

Timeline for d3kxse_: