Class a: All alpha proteins [46456] (286 folds) |
Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily) 5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle |
Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (1 family) automatically mapped to Pfam PF00906 |
Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins) |
Protein Hepatitis B viral capsid (hbcag) [47854] (1 species) |
Species Hepatitis B virus [TaxId:10407] [47855] (1 PDB entry) |
Domain d1qgtb_: 1qgt B: [18136] |
PDB Entry: 1qgt (more details), 3.3 Å
SCOPe Domain Sequences for d1qgtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgtb_ a.62.1.1 (B:) Hepatitis B viral capsid (hbcag) {Hepatitis B virus [TaxId: 10407]} mdidpykefgatvellsflpsdffpsvrdlldtasalyrealespehcsphhtalrqail cwgelmtlatwvgnnledpasrdlvvnyvntnmglkirqllwfhiscltfgretvleylv sfgvwirtppayrppnapilstl
Timeline for d1qgtb_: