Lineage for d3i8vb_ (3i8v B:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.2: PDEase [48548] (7 proteins)
Pfam PF00233; multihelical; can be divided into three subdomains
Protein automated matches [190370] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187208] (23 PDB entries) 
Domain d3i8vb_: 3i8v B: [196548]
automated match to d2qykb_
complexed with 0mo, co, gol, mg, zn
Details for d3i8vb_
PDB Entry: 3i8v (more details), 2.25 Å
PDB Description: Crystal structure of human PDE4a with 4-(3-butoxy-4-methoxyphenyl)methyl-2-imidazolidone
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4ASCOPe Domain Sequences for d3i8vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i8vb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkfr
ipvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalfa
aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskrq
rqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvhc
adlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidyi
vhplwetwadlvhpdaqeildtlednrdwyysai
SCOPe Domain Coordinates for d3i8vb_:
Click to download the PDB-style file with coordinates for d3i8vb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3i8vb_:
- d3i8vb_ first appeared in SCOPe 2.02
- d3i8vb_ appears in SCOPe 2.03
- d3i8vb_ appears in SCOPe 2.05
- d3i8vb_ appears in the current release, SCOPe 2.08, called d3i8vb1
View in 3D
