Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [225665] (1 PDB entry) |
Domain d3h1sb1: 3h1s B:1-83 [210782] Other proteins in same PDB: d3h1sa2, d3h1sb2 automated match to d1jr9a1 complexed with fe, gol |
PDB Entry: 3h1s (more details), 1.9 Å
SCOPe Domain Sequences for d3h1sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h1sb1 a.2.11.0 (B:1-83) automated matches {Francisella tularensis [TaxId: 119856]} mkfelpklpyavdalestisketieyhygkhhqtyvtnlnnlvegtehdgrnleeivkts nggifnnaaqvfnhtfywncltp
Timeline for d3h1sb1: