SCOPe 2.08: Domain d3h1sa2: 3h1s A:84-191

Lineage for d3h1sa2 (3h1s A:84-191)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [225666] (1 PDB entry)

8. Domain d3h1sa2: 3h1s A:84-191 [210781]
   Other proteins in same PDB: d3h1sa1, d3h1sb1
   automated match to d1jr9a2
   complexed with fe, gol

Details for d3h1sa2

PDB Entry: 3h1s, 1.9 Å

PDB Description: crystal structure of superoxide dismutase from francisella tularensis subsp. tularensis schu s4

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d3h1sa2:

Sequence; same for both SEQRES and ATOM records:

>d3h1sa2 d.44.1.0 (A:84-191) automated matches {Francisella tularensis [TaxId: 119856]}
nkteassqlkaalietfgsvenfkeqfskaaiatfgsgwawlvkntegkleivttsnagc
pltenkkplltfdvwehayyidyrnarpkyvealwdivnwqfvseqfa

Timeline for d3h1sa2:

• d3h1sa2 first appeared in SCOPe 2.03
  
• d3h1sa2 appears in SCOPe 2.07