Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189959] (13 PDB entries) |
Domain d3dj1a_: 3dj1 A: [239212] automated match to d3dj1b_ complexed with so4 |
PDB Entry: 3dj1 (more details), 1.8 Å
SCOPe Domain Sequences for d3dj1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dj1a_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqqsml
Timeline for d3dj1a_: