![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
![]() | Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
![]() | Protein Protein H of glycine cleavage system [51236] (4 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries) |
![]() | Domain d3a7la_: 3a7l A: [171847] automated match to d1onla_ |
PDB Entry: 3a7l (more details), 1.3 Å
SCOPe Domain Sequences for d3a7la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7la_ b.84.1.1 (A:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]} snvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcava esvkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldata yeallede
Timeline for d3a7la_: