Lineage for d2z2mc1 (2z2m C:626-692)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929489Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 2929490Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (2 families) (S)
    duplication: consists of 2 subdomains of this fold
  5. 2929491Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 2929492Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 2929493Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 2929510Domain d2z2mc1: 2z2m C:626-692 [153944]
    Other proteins in same PDB: d2z2mb_, d2z2me_
    automated match to d2z2mc1
    complexed with cds, so4

Details for d2z2mc1

PDB Entry: 2z2m (more details), 2.6 Å

PDB Description: cefditoren-acylated penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
PDB Compounds: (C:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2z2mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z2mc1 d.11.1.1 (C:626-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
aleqvsqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqq
vlilsdk

SCOPe Domain Coordinates for d2z2mc1:

Click to download the PDB-style file with coordinates for d2z2mc1.
(The format of our PDB-style files is described here.)

Timeline for d2z2mc1:

2929510
d2z2mc1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2z2mc2