Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
Protein automated matches [190903] (22 species) not a true protein |
Species Helicobacter pylori [TaxId:85963] [231104] (2 PDB entries) |
Domain d2orma_: 2orm A: [231105] automated match to d4faza_ |
PDB Entry: 2orm (more details), 2.1 Å
SCOPe Domain Sequences for d2orma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2orma_ d.80.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]} pfiniklvpenggptneqkqqliegvsdlmvkvlnknkasivviidevdsnnyglggesv hhlrqkn
Timeline for d2orma_: