Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Oceanobacillus iheyensis [TaxId:182710] [255531] (3 PDB entries) |
Domain d2oqya2: 2oqy A:123-374 [243359] Other proteins in same PDB: d2oqya1, d2oqyb1, d2oqyc1, d2oqyd1, d2oqye1, d2oqyf1, d2oqyg1, d2oqyh1 automated match to d3sjna2 complexed with mg |
PDB Entry: 2oqy (more details), 2 Å
SCOPe Domain Sequences for d2oqya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqya2 c.1.11.0 (A:123-374) automated matches {Oceanobacillus iheyensis [TaxId: 182710]} rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes llakyqvpdlsw
Timeline for d2oqya2: