SCOPe 2.05: Structural Classification of Proteins

PDB entry 2oqy

View 2oqy on RCSB PDB site
Description: The crystal structure of muconate cycloisomerase from Oceanobacillus iheyensis
Class: isomerase
Keywords: enolase superfamily, structural genomics, Target 9375a, NYSGRC, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2007-02-01, released 2007-03-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqya1, d2oqya2
Chain 'B':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqyb1, d2oqyb2
Chain 'C':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqyc1, d2oqyc2
Chain 'D':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqyd1, d2oqyd2
Chain 'E':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqye1, d2oqye2
Chain 'F':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqyf1, d2oqyf2
Chain 'G':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqyg1, d2oqyg2
Chain 'H':
Compound: Muconate cycloisomerase
Species: Oceanobacillus iheyensis [TaxId:182710]
Gene: OB2843
Database cross-references and differences (RAF-indexed):
- Uniprot Q8EMJ9 (0-End)
Domains in SCOPe 2.05: d2oqyh1, d2oqyh2
Heterogens: MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2oqyA (A:)
mkitdlelhavgiprhtgfvnkhvivkihtdegltgigemsdfshlplysvdlhdlkqgl
lsillgqnpfdlmkinkeltdnfpetmyyyekgsfirngidnalhdlcakyldisvsdfl
ggrvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvk
eefgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktd
ypisehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqel
svgtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgield
esllakyqvpdlswdnvtvhqlqdrtadtks