Lineage for d2odeb_ (2ode B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2004962Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2005012Protein automated matches [190756] (2 species)
    not a true protein
  7. 2005013Species Human (Homo sapiens) [TaxId:9606] [187954] (3 PDB entries)
  8. 2005014Domain d2odeb_: 2ode B: [166648]
    automated match to d2ik8b1
    complexed with alf, gdp, mg

Details for d2odeb_

PDB Entry: 2ode (more details), 1.9 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS8 and activated Gi alpha 3
PDB Compounds: (B:) Regulator of G-protein signaling 8

SCOPe Domain Sequences for d2odeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odeb_ a.91.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
steeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvska
hrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrs
kmyldllsqsq

SCOPe Domain Coordinates for d2odeb_:

Click to download the PDB-style file with coordinates for d2odeb_.
(The format of our PDB-style files is described here.)

Timeline for d2odeb_: