Class a: All alpha proteins [46456] (289 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
Protein automated matches [190756] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187954] (3 PDB entries) |
Domain d2odeb_: 2ode B: [166648] automated match to d2ik8b1 complexed with alf, gdp, mg |
PDB Entry: 2ode (more details), 1.9 Å
SCOPe Domain Sequences for d2odeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2odeb_ a.91.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} steeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstaklvska hrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsyprflrs kmyldllsqsq
Timeline for d2odeb_: