Lineage for d2je6a1 (2je6 A:1-191)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1891941Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 1892003Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 1892017Species Sulfolobus solfataricus [TaxId:2287] [159922] (6 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 1892018Domain d2je6a1: 2je6 A:1-191 [147991]
    Other proteins in same PDB: d2je6a2, d2je6b1, d2je6b2, d2je6i1, d2je6i2, d2je6i3
    complexed with 1pe, cl, peg

Details for d2je6a1

PDB Entry: 2je6 (more details), 1.6 Å

PDB Description: structure of a 9-subunit archaeal exosome
PDB Compounds: (A:) exosome complex exonuclease 2

SCOPe Domain Sequences for d2je6a1:

Sequence, based on SEQRES records: (download)

>d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhisvn
knevvgkl

SCOPe Domain Coordinates for d2je6a1:

Click to download the PDB-style file with coordinates for d2je6a1.
(The format of our PDB-style files is described here.)

Timeline for d2je6a1: