Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein CUG triplet repeat RNA-binding protein 1 [143336] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143337] (2 PDB entries) Uniprot Q92879 383-484 |
Domain d2cpza1: 2cpz A:383-484 [130710] 3rdRBD |
PDB Entry: 2cpz (more details)
SCOPe Domain Sequences for d2cpza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} ltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfidkqtnlsk cfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsk
Timeline for d2cpza1: