Lineage for d2b8pa1 (2b8p A:2-129)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) Protein Nucleoside diphosphate kinase, NDK [54921] (21 species) 
Species Mimivirus [TaxId:315393] [143286] (2 PDB entries)
Uniprot Q5UQL3 2-137
Domain d2b8pa1: 2b8p A:2-129 [128101]
complexed with so4
Details for d2b8pa1
PDB Entry: 2b8p (more details), 2.55 Å
PDB Description: Crystal structure of Acanthamoeba polyphaga mimivirus NDK, the first viral nucleoside diphosphate kinase
PDB Compounds: (A:) Probable nucleoside diphosphate kinaseSCOPe Domain Sequences for d2b8pa1:
Sequence, based on SEQRES records: (download)
>d2b8pa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd
ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav
deisiwfp
Sequence, based on observed residues (ATOM records): (download)
>d2b8pa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]}
qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykeyfndncdfm
vsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsavdeisi
wfp
SCOPe Domain Coordinates for d2b8pa1:
Click to download the PDB-style file with coordinates for d2b8pa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2b8pa1:
- d2b8pa1 first appeared in SCOP 1.73
- d2b8pa1 appears in SCOP 1.75
- d2b8pa1 appears in SCOPe 2.02
- d2b8pa1 appears in the current release, SCOPe 2.08
View in 3D
