Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Hypothetical protein PA1234 [142353] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [142354] (1 PDB entry) Uniprot Q9I4A4 1-166 |
Domain d1z6na1: 1z6n A:1-166 [124530] complexed with mg |
PDB Entry: 1z6n (more details), 1.5 Å
SCOPe Domain Sequences for d1z6na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} masyaelfdigedfaafvghglateqgavarfrqklesnglpsalterlqrierryrllv agemwcpdcqinlaaldfaqrlqpnielaiiskgraeddlrqrlaleriaiplvlvldee fnllgrfverpqavldggpqalaaykagdylehaigdvlaiiegaa
Timeline for d1z6na1: