Lineage for d1yk9a_ (1yk9 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910831Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1910910Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 1910911Protein automated matches [191274] (8 species)
    not a true protein
  7. 1910924Species Mycobacterium tuberculosis [225049] (4 PDB entries)
  8. 1910927Domain d1yk9a_: 1yk9 A: [203201]
    automated match to d2gvzb1
    mutant

Details for d1yk9a_

PDB Entry: 1yk9 (more details), 2.7 Å

PDB Description: crystal structure of a mutant form of the mycobacterial adenylyl cyclase rv1625c
PDB Compounds: (A:) adenylate cyclase

SCOPe Domain Sequences for d1yk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk9a_ d.58.29.0 (A:) automated matches {Mycobacterium tuberculosis}
dkydeasvlfadivgfterasstapadlvrfldrlysafdelvdqhglekievsgdsymv
vsgvprprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgsrrfry
cvwgdavnvasrmestdsvgqiqvpdevyerlkddfvlrerghinvkgkgvmrtwyligr
kvaa

SCOPe Domain Coordinates for d1yk9a_:

Click to download the PDB-style file with coordinates for d1yk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1yk9a_: