Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.0: automated matches [191671] (1 protein) not a true family |
Protein automated matches [191274] (12 species) not a true protein |
Species Mycobacterium tuberculosis [225049] (4 PDB entries) |
Domain d1yk9a_: 1yk9 A: [203201] automated match to d2gvzb1 mutant |
PDB Entry: 1yk9 (more details), 2.7 Å
SCOPe Domain Sequences for d1yk9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yk9a_ d.58.29.0 (A:) automated matches {Mycobacterium tuberculosis} dkydeasvlfadivgfterasstapadlvrfldrlysafdelvdqhglekievsgdsymv vsgvprprpdhtqaladfaldmtnvaaqlkdprgnpvplrvglatgpvvagvvgsrrfry cvwgdavnvasrmestdsvgqiqvpdevyerlkddfvlrerghinvkgkgvmrtwyligr kvaa
Timeline for d1yk9a_: