Lineage for d1wmza_ (1wmz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940650Protein Lectin CEL-I [111262] (1 species)
  7. 1940651Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
    Uniprot Q7M462
  8. 1940652Domain d1wmza_: 1wmz A: [109422]
    complexed with a2g, ca, nga

Details for d1wmza_

PDB Entry: 1wmz (more details), 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine
PDB Compounds: (A:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOPe Domain Sequences for d1wmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

SCOPe Domain Coordinates for d1wmza_:

Click to download the PDB-style file with coordinates for d1wmza_.
(The format of our PDB-style files is described here.)

Timeline for d1wmza_: