SCOPe 2.05: Domain d1wmzd_: 1wmz D:

Lineage for d1wmzd_ (1wmz D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Lectin CEL-I [111262] (1 species)

7. Species Cucumaria echinata [TaxId:40245] [111263] (2 PDB entries)
   Uniprot Q7M462

8. Domain d1wmzd_: 1wmz D: [109425]
   complexed with a2g, ca, nga

Details for d1wmzd_

PDB Entry: 1wmz, 1.7 Å

PDB Description: crystal structure of c-type lectin cel-i complexed with n-acetyl-d- galactosamine

PDB Compounds: (D:) lectin CEL-I, N-acetyl-D-galactosamine-specific C-type

SCOPe Domain Sequences for d1wmzd_:

Sequence; same for both SEQRES and ATOM records:

>d1wmzd_ d.169.1.1 (D:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]}
nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
awndnsaaaqakymckltfe

Timeline for d1wmzd_:

• d1wmzd_ first appeared in SCOP 1.69
  
• d1wmzd_ appears in SCOPe 2.04
  
• d1wmzd_ appears in SCOPe 2.06
  
• d1wmzd_ appears in the current release, SCOPe 2.08