Lineage for d1wd7a_ (1wd7 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.113: HemD-like [69617] (1 superfamily)
duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345Superfamily c.113.1: HemD-like [69618] (1 family) 
automatically mapped to Pfam PF02602Family c.113.1.1: HemD-like [69619] (3 proteins)
Pfam PF02602
Protein Probable uroporphyrinogen-III synthase [117738] (1 species) Species Thermus thermophilus [TaxId:274] [117739] (1 PDB entry)
Uniprot Q5SKH2; TTHA0671
Domain d1wd7a_: 1wd7 A: [114526]
Structural genomics target
Details for d1wd7a_
PDB Entry: 1wd7 (more details), 1.6 Å
PDB Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-2 crystal)
PDB Compounds: (A:) Uroporphyrinogen III SynthaseSCOPe Domain Sequences for d1wd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]}
avrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflatt
gvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpll
pqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdal
afvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgs
llqgfkralqkeva
SCOPe Domain Coordinates for d1wd7a_:
Click to download the PDB-style file with coordinates for d1wd7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wd7a_:
- d1wd7a_ first appeared in SCOP 1.71
- d1wd7a_ appears in SCOPe 2.04
- d1wd7a_ is called d1wd7a1 in SCOPe 2.06
- d1wd7a_ appears in the current release, SCOPe 2.08, called d1wd7a1
View in 3D
