Lineage for d1wd7a_ (1wd7 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594937Fold c.113: HemD-like [69617] (1 superfamily)
    duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345
  4. 594938Superfamily c.113.1: HemD-like [69618] (1 family) (S)
  5. 594939Family c.113.1.1: HemD-like [69619] (2 proteins)
    Pfam 02602
  6. 594940Protein Probable uroporphyrinogen-III synthase [117738] (1 species)
  7. 594941Species Thermus thermophilus [TaxId:274] [117739] (1 PDB entry)
  8. 594942Domain d1wd7a_: 1wd7 A: [114526]

Details for d1wd7a_

PDB Entry: 1wd7 (more details), 1.6 Å

PDB Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-2 crystal)

SCOP Domain Sequences for d1wd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus}
avrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflatt
gvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpll
pqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdal
afvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgs
llqgfkralqkeva

SCOP Domain Coordinates for d1wd7a_:

Click to download the PDB-style file with coordinates for d1wd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1wd7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wd7b_