Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein D2 core SNRNP protein [50186] (3 species) 3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive |
Species Human (Homo sapiens) [TaxId:9606] [50187] (10 PDB entries) |
Domain d1vu2b_: 1vu2 B: [240851] Other proteins in same PDB: d1vu24_, d1vu2a_, d1vu2c_, d1vu2d_, d1vu2f_, d1vu2g_, d1vu2h_, d1vu2i_, d1vu2k_, d1vu2l_, d1vu2n_, d1vu2o_, d1vu2p_, d1vu2q_, d1vu2s_, d1vu2t_, d1vu2v_, d1vu2w_, d1vu2x_, d1vu2y_ complexed with so4 complexed with so4 |
PDB Entry: 1vu2 (more details), 3.1 Å
SCOPe Domain Sequences for d1vu2b_:
Sequence, based on SEQRES records: (download)
>d1vu2b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv lenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliag
>d1vu2b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag
Timeline for d1vu2b_: