Lineage for d1vu2b_ (1vu2 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786990Protein D2 core SNRNP protein [50186] (3 species)
    3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive
  7. 2786991Species Human (Homo sapiens) [TaxId:9606] [50187] (10 PDB entries)
  8. 2786999Domain d1vu2b_: 1vu2 B: [240851]
    Other proteins in same PDB: d1vu24_, d1vu2a_, d1vu2c_, d1vu2d_, d1vu2f_, d1vu2g_, d1vu2h_, d1vu2i_, d1vu2k_, d1vu2l_, d1vu2n_, d1vu2o_, d1vu2p_, d1vu2q_, d1vu2s_, d1vu2t_, d1vu2v_, d1vu2w_, d1vu2x_, d1vu2y_
    complexed with so4
    complexed with so4

Details for d1vu2b_

PDB Entry: 1vu2 (more details), 3.1 Å

PDB Description: The 8S snRNP Assembly Intermediate
PDB Compounds: (B:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d1vu2b_:

Sequence, based on SEQRES records: (download)

>d1vu2b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
lenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliag

Sequence, based on observed residues (ATOM records): (download)

>d1vu2b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
pksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmv
lenvkemwtevpvnkdryiskmflrgdsvivvlrnpliag

SCOPe Domain Coordinates for d1vu2b_:

Click to download the PDB-style file with coordinates for d1vu2b_.
(The format of our PDB-style files is described here.)

Timeline for d1vu2b_: